PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_EF72B5A0D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 99aa    MW: 10908.2 Da    PI: 6.7899
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_EF72B5A0D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB80.32.5e-251475197
                  NF-YB 51 sdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                           sdkcq+ekrktingddllwa+atlGfe+yv+plk+yl+kyr++eg++
  Traes_3AL_EF72B5A0D.1  1 SDKCQKEKRKTINGDDLLWAMATLGFEEYVDPLKIYLQKYRDMEGDS 47
                           89*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-21157IPR009072Histone-fold
SuperFamilySSF471133.59E-16254IPR009072Histone-fold
PRINTSPR006155.7E-12422No hitNo description
PRINTSPR006155.7E-122341No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
SDKCQKEKRK TINGDDLLWA MATLGFEEYV DPLKIYLQKY RDMEGDSKLT SKSGEGSVKK  60
DIIGAHSGAT SSNAQAMVQH GGYAQGMGYM QPQYHNGDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-171425293NF-YB
4awl_B1e-171425394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-171425394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027881e-167GU902788.1 Triticum monococcum nuclear transcription factor Y subunit B4 mRNA, partial cds.
GenBankKJ8622151e-167KJ862215.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B4 mRNA, complete cds.
GenBankKM0787411e-167KM078741.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564550.12e-63PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010232523.12e-63PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotP252094e-54NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLG0TEQ69e-70G0TEQ6_TRIMO; Nuclear transcription factor Y subunit B4 (Fragment)
STRINGMLOC_72428.43e-66(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.15e-33nuclear factor Y, subunit B10